Class b: All beta proteins [48724] (178 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.2: Group II dsDNA viruses VP [49749] (4 families) duplication: consists of two domains of this fold packed together like the nucleoplasmin subunits trimeric; in the trimers, the domains are arranged around pseudo six-fold axis |
Family b.121.2.3: Major capsid protein vp54 [82013] (2 proteins) |
Protein Major capsid protein vp54 [82014] (1 species) |
Species Paramecium bursaria chlorella virus 1, PBCV-1 [TaxId:10506] [82015] (1 PDB entry) a large, lipid-containing, DNA virus |
Domain d1m3yb1: 1m3y B:25-221 [78581] complexed with hg, man, nag, ndg |
PDB Entry: 1m3y (more details), 2 Å
SCOPe Domain Sequences for d1m3yb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m3yb1 b.121.2.3 (B:25-221) Major capsid protein vp54 {Paramecium bursaria chlorella virus 1, PBCV-1 [TaxId: 10506]} tffktvyrrytnfaiesiqqtingsvgfgnkvstqisrngdlitdivvefvltkggnggt tyypaeellqdveleiggqridkhyndwfrtydalfrmnddrynyrrmtdwvnnelvgaq krfyvplifffnqtpglalplialqyhevklyftlasqvqgvnyngssaiagaaqptmsv wvdyifldtqertrfaq
Timeline for d1m3yb1: