Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (2 families) |
Family c.95.1.1: Thiolase-related [53902] (8 proteins) |
Protein Biosynthetic thiolase [53905] (1 species) |
Species Zoogloea ramigera [TaxId:350] [53906] (12 PDB entries) |
Domain d1m3kb2: 1m3k B:269-392 [78568] |
PDB Entry: 1m3k (more details), 1.7 Å
SCOP Domain Sequences for d1m3kb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m3kb2 c.95.1.1 (B:269-392) Biosynthetic thiolase {Zoogloea ramigera} iqplgrivswatvgvdpkvmgtgpipasrkaleragwkigdldlveaneafaaqacavnk dlgwdpsivnvnggaiaighpigasgarilntllfemkrrgarkglatlcigggmgvamc iesl
Timeline for d1m3kb2: