SCOP 1.73: Domain d1m3kb2: 1m3k B:269-392

Lineage for d1m3kb2 (1m3k B:269-392)

Root: SCOP 1.73
Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

Fold c.95: Thiolase-like [53900] (1 superfamily)
consists of two similar domains related by pseudo dyad; duplication
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

Superfamily c.95.1: Thiolase-like [53901] (2 families)
Family c.95.1.1: Thiolase-related [53902] (8 proteins)
Protein Biosynthetic thiolase [53905] (1 species)
Species Zoogloea ramigera [TaxId:350] [53906] (12 PDB entries)
Domain d1m3kb2: 1m3k B:269-392 [78568]

Details for d1m3kb2

PDB Entry: 1m3k (more details), 1.7 Å

PDB Description: biosynthetic thiolase, inactive c89a mutant

PDB Compounds: (B:) Acetyl-CoA acetyltransferase

SCOP Domain Sequences for d1m3kb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m3kb2 c.95.1.1 (B:269-392) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]}
iqplgrivswatvgvdpkvmgtgpipasrkaleragwkigdldlveaneafaaqacavnk
dlgwdpsivnvnggaiaighpigasgarilntllfemkrrgarkglatlcigggmgvamc
iesl

SCOP Domain Coordinates for d1m3kb2:

Click to download the PDB-style file with coordinates for d1m3kb2.
(The format of our PDB-style files is described here.)

Timeline for d1m3kb2: