Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families) division into families based on beta-sheet topologies |
Family c.37.1.10: Nitrogenase iron protein-like [52652] (8 proteins) core: parallel beta-sheet of 7 strands; order 3241567 |
Protein Nitrogenase iron protein [52661] (2 species) |
Species Azotobacter vinelandii [TaxId:354] [52662] (11 PDB entries) |
Domain d1m34p_: 1m34 P: [78530] Other proteins in same PDB: d1m34a_, d1m34b_, d1m34c_, d1m34d_, d1m34i_, d1m34j_, d1m34k_, d1m34l_ complexed with adp, alf, ca, cfm, clf, fs4, hca, mg |
PDB Entry: 1m34 (more details), 2.3 Å
SCOP Domain Sequences for d1m34p_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m34p_ c.37.1.10 (P:) Nitrogenase iron protein {Azotobacter vinelandii} amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey ralarkvvdnkllvipnpitmdeleellmefgim
Timeline for d1m34p_: