Lineage for d1m34n_ (1m34 N:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242911Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 242912Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families) (S)
    division into families based on beta-sheet topologies
  5. 243628Family c.37.1.10: Nitrogenase iron protein-like [52652] (8 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 243741Protein Nitrogenase iron protein [52661] (2 species)
  7. 243742Species Azotobacter vinelandii [TaxId:354] [52662] (11 PDB entries)
  8. 243756Domain d1m34n_: 1m34 N: [78528]
    Other proteins in same PDB: d1m34a_, d1m34b_, d1m34c_, d1m34d_, d1m34i_, d1m34j_, d1m34k_, d1m34l_

Details for d1m34n_

PDB Entry: 1m34 (more details), 2.3 Å

PDB Description: nitrogenase complex from azotobacter vinelandii stabilized by adp- tetrafluoroaluminate

SCOP Domain Sequences for d1m34n_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m34n_ c.37.1.10 (N:) Nitrogenase iron protein {Azotobacter vinelandii}
amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
ralarkvvdnkllvipnpitmdeleellmefgim

SCOP Domain Coordinates for d1m34n_:

Click to download the PDB-style file with coordinates for d1m34n_.
(The format of our PDB-style files is described here.)

Timeline for d1m34n_: