Lineage for d1m2va2 (1m2v A:2-44,A:391-523)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 552572Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 552971Superfamily b.2.8: beta-sandwich domain of Sec23/24 [81995] (1 family) (S)
  5. 552972Family b.2.8.1: beta-sandwich domain of Sec23/24 [81996] (2 proteins)
  6. 552973Protein Sec23 [81997] (1 species)
  7. 552974Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81998] (2 PDB entries)
  8. 552977Domain d1m2va2: 1m2v A:2-44,A:391-523 [78493]
    Other proteins in same PDB: d1m2va1, d1m2va3, d1m2va4, d1m2va5, d1m2vb1, d1m2vb2, d1m2vb3, d1m2vb4, d1m2vb5
    complexed with zn

Details for d1m2va2

PDB Entry: 1m2v (more details), 2.75 Å

PDB Description: Crystal Structure of the yeast Sec23/24 heterodimer

SCOP Domain Sequences for d1m2va2:

Sequence, based on SEQRES records: (download)

>d1m2va2 b.2.8.1 (A:2-44,A:391-523) Sec23 {Baker's yeast (Saccharomyces cerevisiae)}
dfetnedingvrftwnvfpstrsdansnvvpvgclytplkeydXdeegylkmafngnmav
ktskdlkvqglighasavkktdanniseseigigatstwkmaslspyhsyaiffeianta
ansnpmmsapgsadrphlaytqfittyqhssgtnrirvttvanqllpfgtpaiaasf

Sequence, based on observed residues (ATOM records): (download)

>d1m2va2 b.2.8.1 (A:2-44,A:391-523) Sec23 {Baker's yeast (Saccharomyces cerevisiae)}
dfetnedingvrftwnvfpstrsdansnvvpvgclytplkeydXdeegylkmafngnmav
ktskdlkvqglighasavkktdanniseseigigatstwkmaslspyhsyaiffeiantr
phlaytqfittyqhssgtnrirvttvanqllpfgtpaiaasf

SCOP Domain Coordinates for d1m2va2:

Click to download the PDB-style file with coordinates for d1m2va2.
(The format of our PDB-style files is described here.)

Timeline for d1m2va2: