Lineage for d1m2va1 (1m2v A:524-626)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 540256Fold a.71: ERP29 C domain-like [47932] (2 superfamilies)
    5 helices; bundle
  4. 540266Superfamily a.71.2: Helical domain of Sec23/24 [81811] (1 family) (S)
  5. 540267Family a.71.2.1: Helical domain of Sec23/24 [81812] (2 proteins)
  6. 540268Protein Sec23 [81813] (1 species)
  7. 540269Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81814] (2 PDB entries)
  8. 540272Domain d1m2va1: 1m2v A:524-626 [78492]
    Other proteins in same PDB: d1m2va2, d1m2va3, d1m2va4, d1m2va5, d1m2vb1, d1m2vb2, d1m2vb3, d1m2vb4, d1m2vb5
    complexed with zn

Details for d1m2va1

PDB Entry: 1m2v (more details), 2.75 Å

PDB Description: Crystal Structure of the yeast Sec23/24 heterodimer

SCOP Domain Sequences for d1m2va1:

Sequence, based on SEQRES records: (download)

>d1m2va1 a.71.2.1 (A:524-626) Sec23 {Baker's yeast (Saccharomyces cerevisiae)}
dqeaaavlmariavhkaetddgadvirwldrtliklcqkyadynkddpqsfrlapnfsly
pqftyylrrsqflsvfnnspdetafyrhiftredttnslimiq

Sequence, based on observed residues (ATOM records): (download)

>d1m2va1 a.71.2.1 (A:524-626) Sec23 {Baker's yeast (Saccharomyces cerevisiae)}
dqeaaavlmariavhkaetdvirwldrtliklcqkyadynkddpqsfrlapnfslypqft
yylrrsqflsvfnnspdetafyrhiftredttnslimiq

SCOP Domain Coordinates for d1m2va1:

Click to download the PDB-style file with coordinates for d1m2va1.
(The format of our PDB-style files is described here.)

Timeline for d1m2va1: