Lineage for d1m2va4 (1m2v A:627-768)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 609305Fold d.109: Gelsolin-like [55752] (2 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 609423Superfamily d.109.2: C-terminal, gelsolin-like domain of Sec23/24 [82754] (1 family) (S)
  5. 609424Family d.109.2.1: C-terminal, gelsolin-like domain of Sec23/24 [82755] (2 proteins)
  6. 609425Protein Sec23 [82756] (1 species)
  7. 609426Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82757] (2 PDB entries)
  8. 609429Domain d1m2va4: 1m2v A:627-768 [78495]
    Other proteins in same PDB: d1m2va1, d1m2va2, d1m2va3, d1m2va5, d1m2vb1, d1m2vb2, d1m2vb3, d1m2vb4, d1m2vb5
    complexed with zn

Details for d1m2va4

PDB Entry: 1m2v (more details), 2.75 Å

PDB Description: Crystal Structure of the yeast Sec23/24 heterodimer

SCOP Domain Sequences for d1m2va4:

Sequence, based on SEQRES records: (download)

>d1m2va4 d.109.2.1 (A:627-768) Sec23 {Baker's yeast (Saccharomyces cerevisiae)}
ptltsfsmeddpqpvlldsisvkpntillldtfffiliyhgeqiaqwrkagyqddpqyad
fkalleepkleaaellvdrfplprfidteaggsqarfllsklnpsdnyqdmarggstivl
tddvslqnfmthlqqvavsgqa

Sequence, based on observed residues (ATOM records): (download)

>d1m2va4 d.109.2.1 (A:627-768) Sec23 {Baker's yeast (Saccharomyces cerevisiae)}
ptltsfsmeddpqpvlldsisvkpntillldtfffiliyhgeqiaqwrkagyqddpqyad
fkalleepkleaaellvdrfplprfidteaggsqarfllsklvslqnfmthlqqvavsgq
a

SCOP Domain Coordinates for d1m2va4:

Click to download the PDB-style file with coordinates for d1m2va4.
(The format of our PDB-style files is described here.)

Timeline for d1m2va4: