Lineage for d1m1yb_ (1m1y B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2519619Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2519730Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2519806Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (3 proteins)
    contains three domains of this fold; "Helical backbone" holds domains 2 and 3
    both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3
    automatically mapped to Pfam PF00148
  6. 2519892Protein Nitrogenase iron-molybdenum protein, beta chain [81401] (3 species)
    both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3
  7. 2519893Species Azotobacter vinelandii [TaxId:354] [81397] (40 PDB entries)
  8. 2519975Domain d1m1yb_: 1m1y B: [78442]
    Other proteins in same PDB: d1m1ya_, d1m1yc_, d1m1ye_, d1m1yf_, d1m1yg_, d1m1yh_, d1m1yi_, d1m1yk_, d1m1ym_, d1m1yn_, d1m1yo_, d1m1yp_
    chemically crosslinked structure
    complexed with ca, cfm, clf, hca, sf4

Details for d1m1yb_

PDB Entry: 1m1y (more details), 3.2 Å

PDB Description: chemical crosslink of nitrogenase mofe protein and fe protein
PDB Compounds: (B:) nitrogenase molybdenum-iron protein beta chain

SCOPe Domain Sequences for d1m1yb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1yb_ c.92.2.3 (B:) Nitrogenase iron-molybdenum protein, beta chain {Azotobacter vinelandii [TaxId: 354]}
sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknatv
yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr

SCOPe Domain Coordinates for d1m1yb_:

Click to download the PDB-style file with coordinates for d1m1yb_.
(The format of our PDB-style files is described here.)

Timeline for d1m1yb_: