SCOP 1.63: Domain d1m1ga2: 1m1g A:191-248

Lineage for d1m1ga2 (1m1g A:191-248)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.34: SH3-like barrel [50036] (12 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (4 families)
   many known members contain KOW motif

5. Family b.34.5.4: N-utilization substance G protein NusG, C-terminal domain [82072] (1 protein)

6. Protein N-utilization substance G protein NusG, C-terminal domain [82073] (1 species)

7. Species Aquifex aeolicus [TaxId:63363] [82074] (1 PDB entry)

8. Domain d1m1ga2: 1m1g A:191-248 [78404]
   Other proteins in same PDB: d1m1ga1, d1m1ga3, d1m1gb1, d1m1gb3, d1m1gc1, d1m1gc3, d1m1gd1, d1m1gd3

Details for d1m1ga2

PDB Entry: 1m1g, 2 Å

PDB Description: Crystal Structure of Aquifex aeolicus N-utilization substance G (NusG), Space Group P2(1)

SCOP Domain Sequences for d1m1ga2:

Sequence; same for both SEQRES and ATOM records:

>d1m1ga2 b.34.5.4 (A:191-248) N-utilization substance G protein NusG, C-terminal domain {Aquifex aeolicus}
skvefekgdqvrviegpfmnftgtveevhpekrkltvmisifgrmtpveldfdqveki

Timeline for d1m1ga2:

• d1m1ga2 is new in SCOP 1.63
  
• d1m1ga2 appears in SCOP 1.65
  
• d1m1ga2 appears in the current release, SCOPe 2.08