Lineage for d1m1ga1 (1m1g A:51-131)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1562965Fold b.114: N-utilization substance G protein NusG, insert domain [82003] (1 superfamily)
    sandwich; 8 strands in 2 sheets; meander
  4. 1562966Superfamily b.114.1: N-utilization substance G protein NusG, insert domain [82004] (1 family) (S)
  5. 1562967Family b.114.1.1: N-utilization substance G protein NusG, insert domain [82005] (1 protein)
  6. 1562968Protein N-utilization substance G protein NusG, insert domain [82006] (1 species)
    found only in some NusG species
  7. 1562969Species Aquifex aeolicus [TaxId:63363] [82007] (4 PDB entries)
    interrupted by an insert beta-sandwich domain
  8. 1562975Domain d1m1ga1: 1m1g A:51-131 [78403]
    Other proteins in same PDB: d1m1ga2, d1m1ga3, d1m1gb2, d1m1gb3, d1m1gc2, d1m1gc3, d1m1gd2, d1m1gd3

Details for d1m1ga1

PDB Entry: 1m1g (more details), 2 Å

PDB Description: Crystal Structure of Aquifex aeolicus N-utilization substance G (NusG), Space Group P2(1)
PDB Compounds: (A:) Transcription antitermination protein nusG

SCOPe Domain Sequences for d1m1ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1ga1 b.114.1.1 (A:51-131) N-utilization substance G protein NusG, insert domain {Aquifex aeolicus [TaxId: 63363]}
eekvviraqgkekyrlslkgnardisvlgkkgvttfriengevkvvesvegdtcvnappi
skpgqkitckenkteakivld

SCOPe Domain Coordinates for d1m1ga1:

Click to download the PDB-style file with coordinates for d1m1ga1.
(The format of our PDB-style files is described here.)

Timeline for d1m1ga1: