SCOPe 2.03: Domain d1m1ga1: 1m1g A:51-131

Lineage for d1m1ga1 (1m1g A:51-131)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.114: N-utilization substance G protein NusG, insert domain [82003] (1 superfamily)
   sandwich; 8 strands in 2 sheets; meander

4. Superfamily b.114.1: N-utilization substance G protein NusG, insert domain [82004] (1 family)

5. Family b.114.1.1: N-utilization substance G protein NusG, insert domain [82005] (1 protein)

6. Protein N-utilization substance G protein NusG, insert domain [82006] (1 species)
   found only in some NusG species

7. Species Aquifex aeolicus [TaxId:63363] [82007] (4 PDB entries)
   interrupted by an insert beta-sandwich domain

8. Domain d1m1ga1: 1m1g A:51-131 [78403]
   Other proteins in same PDB: d1m1ga2, d1m1ga3, d1m1gb2, d1m1gb3, d1m1gc2, d1m1gc3, d1m1gd2, d1m1gd3

Details for d1m1ga1

PDB Entry: 1m1g, 2 Å

PDB Description: Crystal Structure of Aquifex aeolicus N-utilization substance G (NusG), Space Group P2(1)

PDB Compounds: (A:) Transcription antitermination protein nusG

SCOPe Domain Sequences for d1m1ga1:

Sequence; same for both SEQRES and ATOM records:

>d1m1ga1 b.114.1.1 (A:51-131) N-utilization substance G protein NusG, insert domain {Aquifex aeolicus [TaxId: 63363]}
eekvviraqgkekyrlslkgnardisvlgkkgvttfriengevkvvesvegdtcvnappi
skpgqkitckenkteakivld

Timeline for d1m1ga1:

• d1m1ga1 first appeared in SCOP 1.63
  
• d1m1ga1 appears in SCOPe 2.02
  
• d1m1ga1 appears in SCOPe 2.04
  
• d1m1ga1 appears in the current release, SCOPe 2.08