SCOPe 2.04: Domain d1m1fb_: 1m1f B:

Lineage for d1m1fb_ (1m1f B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (3 families)
   contains insert beta-sheet subdomain and C-terminal helix

5. Family b.34.6.2: Kid/PemK [82075] (4 proteins)
   automatically mapped to Pfam PF02452

6. Protein Kid toxin protein (ParD) [82076] (1 species)

7. Species Plasmid R1, from Escherichia coli [TaxId:2482] [82077] (2 PDB entries)

8. Domain d1m1fb_: 1m1f B: [78402]
   complexed with po4

Details for d1m1fb_

PDB Entry: 1m1f, 1.4 Å

PDB Description: kid toxin protein from e.coli plasmid r1

PDB Compounds: (B:) kid toxin protein

SCOPe Domain Sequences for d1m1fb_:

Sequence, based on SEQRES records:

>d1m1fb_ b.34.6.2 (B:) Kid toxin protein (ParD) {Plasmid R1, from Escherichia coli [TaxId: 2482]}
mergeiwlvsldptagheqqgtrpvlivtpaafnrvtrlpvvvpvtsggnfartagfavs
ldgvgirttgvvrcdqprtidmkarggkrlervpetimnevlgrlstilt

Sequence, based on observed residues (ATOM records):

>d1m1fb_ b.34.6.2 (B:) Kid toxin protein (ParD) {Plasmid R1, from Escherichia coli [TaxId: 2482]}
mergeiwlvsldptagheqqgtrpvlivtpaafnrvtrlpvvvpvtsrtagfavsldgvg
irttgvvrcdqprtidmkarggkrlervpetimnevlgrlstilt

Timeline for d1m1fb_:

• d1m1fb_ first appeared in SCOP 1.63
  
• d1m1fb_ appears in SCOPe 2.03
  
• d1m1fb_ appears in SCOPe 2.05
  
• d1m1fb_ appears in the current release, SCOPe 2.08