Class b: All beta proteins [48724] (174 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (3 families) contains insert beta-sheet subdomain and C-terminal helix |
Family b.34.6.2: Kid/PemK [82075] (4 proteins) automatically mapped to Pfam PF02452 |
Protein Kid toxin protein (ParD) [82076] (1 species) |
Species Plasmid R1, from Escherichia coli [TaxId:2482] [82077] (2 PDB entries) |
Domain d1m1fb_: 1m1f B: [78402] complexed with po4 |
PDB Entry: 1m1f (more details), 1.4 Å
SCOPe Domain Sequences for d1m1fb_:
Sequence, based on SEQRES records: (download)
>d1m1fb_ b.34.6.2 (B:) Kid toxin protein (ParD) {Plasmid R1, from Escherichia coli [TaxId: 2482]} mergeiwlvsldptagheqqgtrpvlivtpaafnrvtrlpvvvpvtsggnfartagfavs ldgvgirttgvvrcdqprtidmkarggkrlervpetimnevlgrlstilt
>d1m1fb_ b.34.6.2 (B:) Kid toxin protein (ParD) {Plasmid R1, from Escherichia coli [TaxId: 2482]} mergeiwlvsldptagheqqgtrpvlivtpaafnrvtrlpvvvpvtsrtagfavsldgvg irttgvvrcdqprtidmkarggkrlervpetimnevlgrlstilt
Timeline for d1m1fb_: