Lineage for d1m1fb_ (1m1f B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309919Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1311017Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (3 families) (S)
    contains insert beta-sheet subdomain and C-terminal helix
  5. 1311048Family b.34.6.2: Kid/PemK [82075] (4 proteins)
    automatically mapped to Pfam PF02452
  6. 1311049Protein Kid toxin protein (ParD) [82076] (1 species)
  7. 1311050Species Plasmid R1, from Escherichia coli [TaxId:2482] [82077] (2 PDB entries)
  8. 1311052Domain d1m1fb_: 1m1f B: [78402]
    complexed with po4

Details for d1m1fb_

PDB Entry: 1m1f (more details), 1.4 Å

PDB Description: kid toxin protein from e.coli plasmid r1
PDB Compounds: (B:) kid toxin protein

SCOPe Domain Sequences for d1m1fb_:

Sequence, based on SEQRES records: (download)

>d1m1fb_ b.34.6.2 (B:) Kid toxin protein (ParD) {Plasmid R1, from Escherichia coli [TaxId: 2482]}
mergeiwlvsldptagheqqgtrpvlivtpaafnrvtrlpvvvpvtsggnfartagfavs
ldgvgirttgvvrcdqprtidmkarggkrlervpetimnevlgrlstilt

Sequence, based on observed residues (ATOM records): (download)

>d1m1fb_ b.34.6.2 (B:) Kid toxin protein (ParD) {Plasmid R1, from Escherichia coli [TaxId: 2482]}
mergeiwlvsldptagheqqgtrpvlivtpaafnrvtrlpvvvpvtsrtagfavsldgvg
irttgvvrcdqprtidmkarggkrlervpetimnevlgrlstilt

SCOPe Domain Coordinates for d1m1fb_:

Click to download the PDB-style file with coordinates for d1m1fb_.
(The format of our PDB-style files is described here.)

Timeline for d1m1fb_: