SCOPe 2.06: Domain d1m1dc_: 1m1d C:

Lineage for d1m1dc_ (1m1d C:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)

6. Protein Catalytic domain of GCN5 histone acetyltransferase [55737] (3 species)

7. Species Tetrahymena thermophila [TaxId:5911] [55739] (9 PDB entries)
   Uniprot Q27198 49-209

8. Domain d1m1dc_: 1m1d C: [78398]
   complex with bisubstrate analog inhibitor

Details for d1m1dc_

PDB Entry: 1m1d, 2.2 Å

PDB Description: tetrahymena gcn5 with bound bisubstrate analog inhibitor

PDB Compounds: (C:) tgcn5 histone acetyl transferase

SCOPe Domain Sequences for d1m1dc_:

Sequence; same for both SEQRES and ATOM records:

>d1m1dc_ d.108.1.1 (C:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]}
ldfdiltndgthrnmkllidlknifsrqlpkmpkeyivklvfdrhhesmvilknkqkvig
gicfrqykpqrfaevaflavtaneqvrgygtrlmnkfkdhmqkqnieylltyadnfaigy
fkkqgftkehrmpqekwkgyikdydggtlmecyihpyvdygr

Timeline for d1m1dc_:

• d1m1dc_ first appeared in SCOP 1.63
  
• d1m1dc_ appears in SCOPe 2.05
  
• d1m1dc_ appears in SCOPe 2.07
  
• d1m1dc_ appears in the current release, SCOPe 2.08