| Class a: All alpha proteins [46456] (171 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (3 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (4 proteins) form octamers composed of two copies of each of the four histones |
| Protein Histone H2B [47119] (3 species) |
| Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (8 PDB entries) |
| Domain d1m1ad_: 1m1a D: [78390] Other proteins in same PDB: d1m1aa_, d1m1ab_, d1m1ac_, d1m1ae_, d1m1af_, d1m1ag_ |
PDB Entry: 1m1a (more details), 2.65 Å
SCOP Domain Sequences for d1m1ad_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m1ad_ a.22.1.1 (D:) Histone H2B {African clawed frog (Xenopus laevis)}
trkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstits
reiqtavrlllpgelakhavsegtkavtkytsa
Timeline for d1m1ad_: