SCOP 1.73: Domain d1m1ac_: 1m1a C:

Lineage for d1m1ac_ (1m1a C:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (4 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (5 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H2A [47115] (5 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47117] (20 PDB entries)

8. Domain d1m1ac_: 1m1a C: [78389]
   Other proteins in same PDB: d1m1aa_, d1m1ab_, d1m1ad_, d1m1ae_, d1m1af_, d1m1ah_

Details for d1m1ac_

PDB Entry: 1m1a, 2.65 Å

PDB Description: ligand binding alters the structure and dynamics of nucleosomal dna

PDB Compounds: (C:) histone h2a.1

SCOP Domain Sequences for d1m1ac_:

Sequence; same for both SEQRES and ATOM records:

>d1m1ac_ a.22.1.1 (C:) Histone H2A {African clawed frog (Xenopus laevis) [TaxId: 8355]}
aktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardn
kktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpk

Timeline for d1m1ac_:

• d1m1ac_ first appeared in SCOP 1.63
  
• d1m1ac_ appears in SCOP 1.71
  
• d1m1ac_ appears in SCOP 1.75
  
• d1m1ac_ appears in the current release, SCOPe 2.08