Lineage for d1m19f_ (1m19 F:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1262429Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1262430Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1262431Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1262745Protein Histone H4 [47125] (7 species)
  7. 1262746Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (38 PDB entries)
  8. 1262757Domain d1m19f_: 1m19 F: [78384]
    Other proteins in same PDB: d1m19a_, d1m19c_, d1m19d_, d1m19e_, d1m19g_, d1m19h_
    protein/DNA complex; complexed with imt, mn

Details for d1m19f_

PDB Entry: 1m19 (more details), 2.3 Å

PDB Description: ligand binding alters the structure and dynamics of nucleosomal dna
PDB Compounds: (F:) histone h4

SCOPe Domain Sequences for d1m19f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m19f_ a.22.1.1 (F:) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
rhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtyteha
krktvtamdvvyalkrqgrtlygfgg

SCOPe Domain Coordinates for d1m19f_:

Click to download the PDB-style file with coordinates for d1m19f_.
(The format of our PDB-style files is described here.)

Timeline for d1m19f_: