| Class a: All alpha proteins [46456] (258 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (4 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (5 proteins) form octamers composed of two copies of each of the four histones |
| Protein Histone H2A [47115] (5 species) |
| Species African clawed frog (Xenopus laevis) [TaxId:8355] [47117] (20 PDB entries) |
| Domain d1m18g_: 1m18 G: [78377] Other proteins in same PDB: d1m18a_, d1m18b_, d1m18d_, d1m18e_, d1m18f_, d1m18h_ complexed with abu, bal, dib, imt, mn, pyb |
PDB Entry: 1m18 (more details), 2.45 Å
SCOP Domain Sequences for d1m18g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m18g_ a.22.1.1 (G:) Histone H2A {African clawed frog (Xenopus laevis) [TaxId: 8355]}
aktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardn
kktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkk
Timeline for d1m18g_: