Lineage for d1m15a2 (1m15 A:96-357)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1040112Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 1040113Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (5 families) (S)
  5. 1040244Family d.128.1.2: Guanido kinase catalytic domain [55935] (2 proteins)
  6. 1040245Protein Arginine kinase, C-terminal domain [55942] (1 species)
  7. 1040246Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [55943] (7 PDB entries)
    Uniprot P51541
  8. 1040247Domain d1m15a2: 1m15 A:96-357 [78369]
    Other proteins in same PDB: d1m15a1
    complexed with adp, arg, mg, no3

Details for d1m15a2

PDB Entry: 1m15 (more details), 1.2 Å

PDB Description: transition state structure of arginine kinase
PDB Compounds: (A:) arginine kinase

SCOPe Domain Sequences for d1m15a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m15a2 d.128.1.2 (A:96-357) Arginine kinase, C-terminal domain {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]}
tdkhppkqwgdintlvgldpagqfiistrvrcgrslqgypfnpcltaeqykemeekvsst
lssmedelkgtyypltgmskatqqqliddhflfkegdrflqtanacrywptgrgifhnda
ktflvwvneedhlriismqkggdlktvykrlvtavdniesklpfshddrfgfltfcptnl
gttmrasvhiqlpklakdrkvlediaskfnlqvrgtrgehteseggvydisnkrrlglte
yqavremqdgilemikmekaaa

SCOPe Domain Coordinates for d1m15a2:

Click to download the PDB-style file with coordinates for d1m15a2.
(The format of our PDB-style files is described here.)

Timeline for d1m15a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m15a1