SCOP 1.63: Domain d1m15a2: 1m15 A:96-357

Lineage for d1m15a2 (1m15 A:96-357)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.128: Glutamine synthase/guanido kinase [55930] (1 superfamily)

4. Superfamily d.128.1: Glutamine synthase/guanido kinase [55931] (2 families)
   duplication: common core consists of two beta-alpha-beta2-alpha repeats

5. Family d.128.1.2: Guanido kinase catalytic domain [55935] (2 proteins)

6. Protein Arginine kinase, C-terminal domain [55942] (1 species)

7. Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [55943] (3 PDB entries)

8. Domain d1m15a2: 1m15 A:96-357 [78369]
   Other proteins in same PDB: d1m15a1
   complexed with adp, arg, mg, no3; mutant

Details for d1m15a2

PDB Entry: 1m15, 1.2 Å

PDB Description: transition state structure of arginine kinase

SCOP Domain Sequences for d1m15a2:

Sequence; same for both SEQRES and ATOM records:

>d1m15a2 d.128.1.2 (A:96-357) Arginine kinase, C-terminal domain {Horseshoe crab (Limulus polyphemus)}
tdkhppkqwgdintlvgldpagqfiistrvrcgrslqgypfnpcltaeqykemeekvsst
lssmedelkgtyypltgmskatqqqliddhflfkegdrflqtanacrywptgrgifhnda
ktflvwvneedhlriismqkggdlktvykrlvtavdniesklpfshddrfgfltfcptnl
gttmrasvhiqlpklakdrkvlediaskfnlqvrgtrgehteseggvydisnkrrlglte
yqavremqdgilemikmekaaa

Timeline for d1m15a2:

• d1m15a2 is new in SCOP 1.63
  
• d1m15a2 appears in SCOP 1.65
  
• d1m15a2 appears in the current release, SCOPe 2.08