SCOPe 2.07: Domain d1lxfc_: 1lxf C:

Lineage for d1lxfc_ (1lxf C:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Troponin C [47503] (6 species)

7. Species Human (Homo sapiens), cardiac isoform [TaxId:9606] [47508] (28 PDB entries)

8. Domain d1lxfc_: 1lxf C: [78292]
   Other proteins in same PDB: d1lxfi_
   N-domain only; complexed with a troponin I fragment
   complexed with bep, ca

Details for d1lxfc_

PDB Entry: 1lxf

PDB Description: structure of the regulatory n-domain of human cardiac troponin c in complex with human cardiac troponin-i(147-163) and bepridil

PDB Compounds: (C:) troponin c, slow skeletal and cardiac muscles

SCOPe Domain Sequences for d1lxfc_:

Sequence; same for both SEQRES and ATOM records:

>d1lxfc_ a.39.1.5 (C:) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}
mddiykaaveqlteeqknefkaafdifvlgaedgcistkelgkvmrmlgqnptpeelqem
idevdedgsgtvdfdeflvmmvrcmkdds

Timeline for d1lxfc_:

• d1lxfc_ first appeared in SCOP 1.63
  
• d1lxfc_ appears in SCOPe 2.06
  
• d1lxfc_ appears in the current release, SCOPe 2.08