Lineage for d1lxfc_ (1lxf C:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 213166Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 213167Superfamily a.39.1: EF-hand [47473] (9 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 213324Family a.39.1.5: Calmodulin-like [47502] (17 proteins)
    Duplication: made with two pairs of EF-hands
  6. 213494Protein Troponin C [47503] (5 species)
  7. 213524Species Human (Homo sapiens), cardiac isoform [TaxId:9606] [47508] (5 PDB entries)
  8. 213529Domain d1lxfc_: 1lxf C: [78292]
    Other proteins in same PDB: d1lxfi_
    N-domain only; complexed with a troponin I fragment
    complexed with bep, ca

Details for d1lxfc_

PDB Entry: 1lxf (more details)

PDB Description: Structure of the Regulatory N-domain of Human Cardiac Troponin C in Complex with Human Cardiac Troponin-I(147-163) and Bepridil

SCOP Domain Sequences for d1lxfc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lxfc_ a.39.1.5 (C:) Troponin C {Human (Homo sapiens), cardiac isoform}
mddiykaaveqlteeqknefkaafdifvlgaedgcistkelgkvmrmlgqnptpeelqem
idevdedgsgtvdfdeflvmmvrcmkdds

SCOP Domain Coordinates for d1lxfc_:

Click to download the PDB-style file with coordinates for d1lxfc_.
(The format of our PDB-style files is described here.)

Timeline for d1lxfc_: