SCOPe 2.06: Domain d1ltjd_: 1ltj D:

Lineage for d1ltjd_ (1ltj D:)

1. Root: SCOPe 2.06

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (38 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families)

5. Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
   in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails

6. Protein Fibrinogen alpha chain [88887] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88889] (22 PDB entries)
   Uniprot P02671 150-209

8. Domain d1ltjd_: 1ltj D: [78203]
   Other proteins in same PDB: d1ltjb1, d1ltjb2, d1ltjc1, d1ltjc2, d1ltje1, d1ltje2, d1ltjf1, d1ltjf2
   coiled-coil region only
   complexed with ca

Details for d1ltjd_

PDB Entry: 1ltj, 2.8 Å

PDB Description: crystal structure of recombinant human fibrinogen fragment d with the peptide ligands gly-pro-arg-pro-amide and gly-his-arg-pro-amide

PDB Compounds: (D:) Fibrinogen alpha/alpha-E Chain

SCOPe Domain Sequences for d1ltjd_:

Sequence; same for both SEQRES and ATOM records:

>d1ltjd_ h.1.8.1 (D:) Fibrinogen alpha chain {Human (Homo sapiens) [TaxId: 9606]}
iqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyedqqkqleqvia

Timeline for d1ltjd_:

• d1ltjd_ first appeared in SCOP 1.63
  
• d1ltjd_ appears in SCOPe 2.05
  
• d1ltjd_ appears in SCOPe 2.07
  
• d1ltjd_ appears in the current release, SCOPe 2.08