Lineage for d1ltjb1 (1ltj B:200-458)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2235801Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
    unusual fold
  4. 2235802Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (2 families) (S)
  5. 2235803Family d.171.1.1: Fibrinogen C-terminal domain-like [56497] (2 proteins)
    automatically mapped to Pfam PF00147
  6. 2235804Protein Fibrinogen C-terminal domains [56498] (7 species)
  7. 2235811Species Human (Homo sapiens), beta [TaxId:9606] [68903] (14 PDB entries)
    Uniprot P02675
  8. 2235820Domain d1ltjb1: 1ltj B:200-458 [78199]
    Other proteins in same PDB: d1ltja_, d1ltjb2, d1ltjc2, d1ltjd_, d1ltje2, d1ltjf2
    complexed with ca

Details for d1ltjb1

PDB Entry: 1ltj (more details), 2.8 Å

PDB Description: crystal structure of recombinant human fibrinogen fragment d with the peptide ligands gly-pro-arg-pro-amide and gly-his-arg-pro-amide
PDB Compounds: (B:) fibrinogen beta chain

SCOPe Domain Sequences for d1ltjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ltjb1 d.171.1.1 (B:200-458) Fibrinogen C-terminal domains {Human (Homo sapiens), beta [TaxId: 9606]}
scnipvvsgkeceeiirkggetsemyliqpdssvkpyrvycdmntenggwtviqnrqdgs
vdfgrkwdpykqgfgnvatntdgknycglpgeywlgndkisqltrmgptelliemedwkg
dkvkahyggftvqneankyqisvnkyrgtagnalmdgasqlmgenrtmtihngmffstyd
rdndgwltsdprkqcskedgggwwynrchaanpngryywggqytwdmakhgtddgvvwmn
wkgswysmrkmsmkirpff

SCOPe Domain Coordinates for d1ltjb1:

Click to download the PDB-style file with coordinates for d1ltjb1.
(The format of our PDB-style files is described here.)

Timeline for d1ltjb1: