SCOP 1.67: Domain d1lt9b2: 1lt9 B:161-199

Lineage for d1lt9b2 (1lt9 B:161-199)

1. Root: SCOP 1.67

2. Class h: Coiled coil proteins [57942] (6 folds)

3. Fold h.1: Parallel coiled-coil [57943] (27 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family)

5. Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
   in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails

6. Protein Fibrinogen beta chain [88892] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88895] (13 PDB entries)

8. Domain d1lt9b2: 1lt9 B:161-199 [78190]
   Other proteins in same PDB: d1lt9a_, d1lt9b1, d1lt9c1, d1lt9c2, d1lt9d_, d1lt9e1, d1lt9f1, d1lt9f2

Details for d1lt9b2

PDB Entry: 1lt9, 2.8 Å

PDB Description: crystal structure of recombinant human fibrinogen fragment d

SCOP Domain Sequences for d1lt9b2:

Sequence; same for both SEQRES and ATOM records:

>d1lt9b2 h.1.8.1 (B:161-199) Fibrinogen beta chain {Human (Homo sapiens)}
iptnlrvlrsilenlrskiqklesdvsaqmeycrtpctv

Timeline for d1lt9b2:

• d1lt9b2 first appeared in SCOP 1.63
  
• d1lt9b2 appears in SCOP 1.65
  
• d1lt9b2 appears in SCOP 1.69
  
• d1lt9b2 appears in the current release, SCOPe 2.08