Lineage for d1lt9a_ (1lt9 A:)

  1. Root: SCOP 1.67
  2. 431023Class h: Coiled coil proteins [57942] (6 folds)
  3. 431024Fold h.1: Parallel coiled-coil [57943] (27 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 431436Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) (S)
  5. 431437Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
    in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  6. 431438Protein Fibrinogen alpha chain [88887] (4 species)
  7. 431447Species Human (Homo sapiens) [TaxId:9606] [88889] (13 PDB entries)
  8. 431458Domain d1lt9a_: 1lt9 A: [78188]
    Other proteins in same PDB: d1lt9b1, d1lt9b2, d1lt9c1, d1lt9c2, d1lt9e1, d1lt9e2, d1lt9f1, d1lt9f2

Details for d1lt9a_

PDB Entry: 1lt9 (more details), 2.8 Å

PDB Description: crystal structure of recombinant human fibrinogen fragment d

SCOP Domain Sequences for d1lt9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lt9a_ h.1.8.1 (A:) Fibrinogen alpha chain {Human (Homo sapiens)}
viekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyedqqkql
eqvia

SCOP Domain Coordinates for d1lt9a_:

Click to download the PDB-style file with coordinates for d1lt9a_.
(The format of our PDB-style files is described here.)

Timeline for d1lt9a_: