Lineage for d1lt9b2 (1lt9 B:161-199)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3039948Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families) (S)
  5. 3039949Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
    in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  6. 3040014Protein Fibrinogen beta chain [88892] (4 species)
  7. 3040023Species Human (Homo sapiens) [TaxId:9606] [88895] (15 PDB entries)
    Uniprot P02675
  8. 3040038Domain d1lt9b2: 1lt9 B:161-199 [78190]
    Other proteins in same PDB: d1lt9a_, d1lt9b1, d1lt9c1, d1lt9c2, d1lt9d_, d1lt9e1, d1lt9f1, d1lt9f2
    coiled-coil region only
    complexed with ca, nag

Details for d1lt9b2

PDB Entry: 1lt9 (more details), 2.8 Å

PDB Description: crystal structure of recombinant human fibrinogen fragment d
PDB Compounds: (B:) fibrinogen beta chain

SCOPe Domain Sequences for d1lt9b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lt9b2 h.1.8.1 (B:161-199) Fibrinogen beta chain {Human (Homo sapiens) [TaxId: 9606]}
iptnlrvlrsilenlrskiqklesdvsaqmeycrtpctv

SCOPe Domain Coordinates for d1lt9b2:

Click to download the PDB-style file with coordinates for d1lt9b2.
(The format of our PDB-style files is described here.)

Timeline for d1lt9b2: