Lineage for d1lqga_ (1lqg A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1157714Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 1157715Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) (S)
  5. 1157716Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins)
  6. 1157717Protein Uracil-DNA glycosylase [52143] (5 species)
  7. 1157724Species Escherichia coli [TaxId:562] [52146] (12 PDB entries)
  8. 1157735Domain d1lqga_: 1lqg A: [78131]
    Other proteins in same PDB: d1lqgc_, d1lqgd_
    protein/DNA complex

Details for d1lqga_

PDB Entry: 1lqg (more details), 2.9 Å

PDB Description: escherichia coli uracil-dna glycosylase complex with uracil-dna glycosylase inhibitor protein
PDB Compounds: (A:) uracil-DNA glycosylase

SCOPe Domain Sequences for d1lqga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lqga_ c.18.1.1 (A:) Uracil-DNA glycosylase {Escherichia coli [TaxId: 562]}
neltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilg
qdpyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvlll
ntvltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhv
lkaphpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpaes

SCOPe Domain Coordinates for d1lqga_:

Click to download the PDB-style file with coordinates for d1lqga_.
(The format of our PDB-style files is described here.)

Timeline for d1lqga_: