Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) |
Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins) |
Protein Uracil-DNA glycosylase [52143] (5 species) |
Species Escherichia coli [TaxId:562] [52146] (12 PDB entries) |
Domain d1lqga_: 1lqg A: [78131] Other proteins in same PDB: d1lqgc_, d1lqgd_ protein/DNA complex |
PDB Entry: 1lqg (more details), 2.9 Å
SCOPe Domain Sequences for d1lqga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lqga_ c.18.1.1 (A:) Uracil-DNA glycosylase {Escherichia coli [TaxId: 562]} neltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilg qdpyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvlll ntvltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhv lkaphpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpaes
Timeline for d1lqga_: