![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.18: DNA glycosylase [52140] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.18.1: DNA glycosylase [52141] (2 families) ![]() |
![]() | Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein) |
![]() | Protein Uracil-DNA glycosylase [52143] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [52146] (12 PDB entries) |
![]() | Domain d1lqga_: 1lqg A: [78131] Other proteins in same PDB: d1lqgc_, d1lqgd_ |
PDB Entry: 1lqg (more details), 2.9 Å
SCOP Domain Sequences for d1lqga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lqga_ c.18.1.1 (A:) Uracil-DNA glycosylase {Escherichia coli} neltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilg qdpyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvlll ntvltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhv lkaphpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpaes
Timeline for d1lqga_: