Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins) |
Protein Class II MHC beta chain, N-terminal domain [88819] (15 species) |
Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88821] (13 PDB entries) |
Domain d1lo5b2: 1lo5 B:3-92 [78119] Other proteins in same PDB: d1lo5a1, d1lo5a2, d1lo5b1, d1lo5d1, d1lo5d2 complexed with a peptide from hemagglutinin mutant |
PDB Entry: 1lo5 (more details), 3.2 Å
SCOP Domain Sequences for d1lo5b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lo5b2 d.19.1.1 (B:3-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]} trprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaeywn sqkdlleqrraavdtycrhnygvgesftvq
Timeline for d1lo5b2:
View in 3D Domains from other chains: (mouse over for more information) d1lo5a1, d1lo5a2, d1lo5d1, d1lo5d2 |