Lineage for d1lo5b2 (1lo5 B:3-92)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 255210Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 255211Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 255212Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)
  6. 255405Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (12 species)
  7. 255412Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [54460] (11 PDB entries)
  8. 255446Domain d1lo5b2: 1lo5 B:3-92 [78119]
    Other proteins in same PDB: d1lo5a1, d1lo5b1, d1lo5d1, d1lo5d2
    complexed with a peptide from hemagglutinin
    mutant

Details for d1lo5b2

PDB Entry: 1lo5 (more details), 3.2 Å

PDB Description: crystal structure of the d227a variant of staphylococcal enterotoxin a in complex with human mhc class ii

SCOP Domain Sequences for d1lo5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lo5b2 d.19.1.1 (B:3-92) MHC class II, N-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1}
trprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaeywn
sqkdlleqrraavdtycrhnygvgesftvq

SCOP Domain Coordinates for d1lo5b2:

Click to download the PDB-style file with coordinates for d1lo5b2.
(The format of our PDB-style files is described here.)

Timeline for d1lo5b2: