Lineage for d1lnsa2 (1lns A:551-763)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1530204Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1530205Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 1530625Family b.18.1.13: PepX C-terminal domain-like [69222] (3 proteins)
  6. 1530671Protein X-Prolyl dipeptidyl aminopeptidase PepX [82020] (1 species)
  7. 1530672Species Lactococcus lactis [TaxId:1358] [82021] (1 PDB entry)
  8. 1530673Domain d1lnsa2: 1lns A:551-763 [78102]
    Other proteins in same PDB: d1lnsa1, d1lnsa3

Details for d1lnsa2

PDB Entry: 1lns (more details), 2.2 Å

PDB Description: crystal structure analysis of the x-prolyl dipeptidyl aminopeptidase from lactococcus lactis
PDB Compounds: (A:) x-prolyl dipeptidyl aminopetidase

SCOPe Domain Sequences for d1lnsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lnsa2 b.18.1.13 (A:551-763) X-Prolyl dipeptidyl aminopeptidase PepX {Lactococcus lactis [TaxId: 1358]}
gantqiklplgktavsfaqfdnnyddetfkkyskdfnvfkkdlfenkaneavidlelpsm
ltingpvelelrlklndtkgflsaqildfgqkkrledkvrvkdfkvldrgrnfmlddlve
lplvespyqlvtkgftnlqnqslltvsdlkadewftikfelqptiyhlekadklrvilys
tdfehtvrdnrkvtyeidlsqskliipiesvkn

SCOPe Domain Coordinates for d1lnsa2:

Click to download the PDB-style file with coordinates for d1lnsa2.
(The format of our PDB-style files is described here.)

Timeline for d1lnsa2: