SCOPe 2.06: Domain d1ll8a1: 1ll8 A:8-114

Lineage for d1ll8a1 (1ll8 A:8-114)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.5: N-terminal PAS domain of Pas kinase [82764] (1 protein)
   automatically mapped to Pfam PF00989
   automatically mapped to Pfam PF13426

6. Protein N-terminal PAS domain of Pas kinase [82765] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82766] (1 PDB entry)

8. Domain d1ll8a1: 1ll8 A:8-114 [78089]
   Other proteins in same PDB: d1ll8a2

Details for d1ll8a1

PDB Entry: 1ll8

PDB Description: structure and interactions of pas kinase n-terminal pas domain: model for intramolecular kinase regulation

PDB Compounds: (A:) PAS Kinase

SCOPe Domain Sequences for d1ll8a1:

Sequence; same for both SEQRES and ATOM records:

>d1ll8a1 d.110.3.5 (A:8-114) N-terminal PAS domain of Pas kinase {Human (Homo sapiens) [TaxId: 9606]}
nkaiftvdaktteilvandkacgllgyssqdligqkltqfflrsdsdvvealseehmead
ghaavvfgtvvdiisrsgekipvsvwmkrmrqerrlccvvvlepver

Timeline for d1ll8a1:

• d1ll8a1 first appeared in SCOP 1.63, called d1ll8a_
  
• d1ll8a1 was called d1ll8a_ in SCOPe 2.05
  
• d1ll8a1 appears in SCOPe 2.07
  
• d1ll8a1 appears in the current release, SCOPe 2.08