Lineage for d1ll8a1 (1ll8 A:8-114)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970344Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2970495Family d.110.3.5: N-terminal PAS domain of Pas kinase [82764] (1 protein)
    automatically mapped to Pfam PF00989
    automatically mapped to Pfam PF13426
  6. 2970496Protein N-terminal PAS domain of Pas kinase [82765] (1 species)
  7. 2970497Species Human (Homo sapiens) [TaxId:9606] [82766] (1 PDB entry)
  8. 2970498Domain d1ll8a1: 1ll8 A:8-114 [78089]
    Other proteins in same PDB: d1ll8a2

Details for d1ll8a1

PDB Entry: 1ll8 (more details)

PDB Description: structure and interactions of pas kinase n-terminal pas domain: model for intramolecular kinase regulation
PDB Compounds: (A:) PAS Kinase

SCOPe Domain Sequences for d1ll8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ll8a1 d.110.3.5 (A:8-114) N-terminal PAS domain of Pas kinase {Human (Homo sapiens) [TaxId: 9606]}
nkaiftvdaktteilvandkacgllgyssqdligqkltqfflrsdsdvvealseehmead
ghaavvfgtvvdiisrsgekipvsvwmkrmrqerrlccvvvlepver

SCOPe Domain Coordinates for d1ll8a1:

Click to download the PDB-style file with coordinates for d1ll8a1.
(The format of our PDB-style files is described here.)

Timeline for d1ll8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ll8a2