| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) ![]() alpha-beta(2)-alpha(2)-beta(3) |
| Family d.110.3.5: N-terminal PAS domain of Pas kinase [82764] (1 protein) automatically mapped to Pfam PF00989 automatically mapped to Pfam PF13426 |
| Protein N-terminal PAS domain of Pas kinase [82765] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [82766] (1 PDB entry) |
| Domain d1ll8a1: 1ll8 A:8-114 [78089] Other proteins in same PDB: d1ll8a2 |
PDB Entry: 1ll8 (more details)
SCOPe Domain Sequences for d1ll8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ll8a1 d.110.3.5 (A:8-114) N-terminal PAS domain of Pas kinase {Human (Homo sapiens) [TaxId: 9606]}
nkaiftvdaktteilvandkacgllgyssqdligqkltqfflrsdsdvvealseehmead
ghaavvfgtvvdiisrsgekipvsvwmkrmrqerrlccvvvlepver
Timeline for d1ll8a1: