Lineage for d1ll8a_ (1ll8 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1427772Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1427979Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 1428101Family d.110.3.5: N-terminal PAS domain of Pas kinase [82764] (1 protein)
    automatically mapped to Pfam PF00989
    automatically mapped to Pfam PF13426
  6. 1428102Protein N-terminal PAS domain of Pas kinase [82765] (1 species)
  7. 1428103Species Human (Homo sapiens) [TaxId:9606] [82766] (1 PDB entry)
  8. 1428104Domain d1ll8a_: 1ll8 A: [78089]

Details for d1ll8a_

PDB Entry: 1ll8 (more details)

PDB Description: structure and interactions of pas kinase n-terminal pas domain: model for intramolecular kinase regulation
PDB Compounds: (A:) PAS Kinase

SCOPe Domain Sequences for d1ll8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ll8a_ d.110.3.5 (A:) N-terminal PAS domain of Pas kinase {Human (Homo sapiens) [TaxId: 9606]}
gamdpefnkaiftvdaktteilvandkacgllgyssqdligqkltqfflrsdsdvveals
eehmeadghaavvfgtvvdiisrsgekipvsvwmkrmrqerrlccvvvlepver

SCOPe Domain Coordinates for d1ll8a_:

Click to download the PDB-style file with coordinates for d1ll8a_.
(The format of our PDB-style files is described here.)

Timeline for d1ll8a_: