PDB entry 1ll8

View 1ll8 on RCSB PDB site
Description: Structure and interactions of PAS kinase N-terminal PAS domain: Model for intramolecular kinase regulation
Class: Transferase
Keywords: PAS Domain, Ligand binding, Ligand screening, kinase regulation, Transferase
Deposited on 2002-04-26, released 2002-10-09
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: PAS Kinase
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q96RG2 (7-113)
    • cloning artifact (0-6)
  Domains in SCOPe 2.03: d1ll8a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ll8A (A:)
  gamdpefnkaiftvdaktteilvandkacgllgyssqdligqkltqfflrsdsdvveals
  eehmeadghaavvfgtvvdiisrsgekipvsvwmkrmrqerrlccvvvlepver