Lineage for d1ljmb_ (1ljm B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1525229Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1525684Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 1526006Family b.2.5.6: RUNT domain [81318] (2 proteins)
    automatically mapped to Pfam PF00853
  6. 1526007Protein Acute myeloid leukemia 1 protein (AML1), RUNT domain [49439] (2 species)
    synonym: core binding factor alpha, cbfa
  7. 1526008Species Human (Homo sapiens) [TaxId:9606] [49440] (5 PDB entries)
  8. 1526010Domain d1ljmb_: 1ljm B: [78052]
    complexed with cl

Details for d1ljmb_

PDB Entry: 1ljm (more details), 2.5 Å

PDB Description: DNA recognition is mediated by conformational transition and by DNA bending
PDB Compounds: (B:) RUNX1 transcription factor

SCOPe Domain Sequences for d1ljmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ljmb_ b.2.5.6 (B:) Acute myeloid leukemia 1 protein (AML1), RUNT domain {Human (Homo sapiens) [TaxId: 9606]}
gelvrtdspnflcsvlpthwrcnktlpiafkvvalgdvpdgtlvtvmagndenysaelrn
ataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikitvdgp

SCOPe Domain Coordinates for d1ljmb_:

Click to download the PDB-style file with coordinates for d1ljmb_.
(The format of our PDB-style files is described here.)

Timeline for d1ljmb_: