SCOP 1.63: Domain d1ljmb_: 1ljm B:

Lineage for d1ljmb_ (1ljm B:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (8 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (6 families)

5. Family b.2.5.6: RUNT domain [81318] (1 protein)

6. Protein Acute myeloid leukemia 1 protein (AML1), RUNT domain [49439] (2 species)
   synonym: core binding factor alpha, cbfa

7. Species Human (Homo sapiens) [TaxId:9606] [49440] (5 PDB entries)

8. Domain d1ljmb_: 1ljm B: [78052]
   complexed with cl

Details for d1ljmb_

PDB Entry: 1ljm, 2.5 Å

PDB Description: DNA recognition is mediated by conformational transition and by DNA bending

SCOP Domain Sequences for d1ljmb_:

Sequence; same for both SEQRES and ATOM records:

>d1ljmb_ b.2.5.6 (B:) Acute myeloid leukemia 1 protein (AML1), RUNT domain {Human (Homo sapiens)}
gelvrtdspnflcsvlpthwrcnktlpiafkvvalgdvpdgtlvtvmagndenysaelrn
ataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikitvdgp

Timeline for d1ljmb_:

• d1ljmb_ is new in SCOP 1.63
  
• d1ljmb_ appears in SCOP 1.65
  
• d1ljmb_ appears in the current release, SCOPe 2.08