SCOPe 2.07: Domain d1lhpb_: 1lhp B:

Lineage for d1lhpb_ (1lhp B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.1: Ribokinase-like [53613] (6 families)
   has extra strand located between strands 2 and 3

5. Family c.72.1.5: PfkB-like kinase [82515] (3 proteins)
   includes a variety of carbohydrate and pyrimidine kinases

6. Protein Pyridoxal kinase [82516] (1 species)

7. Species Sheep (Ovis aries) [TaxId:9940] [82517] (8 PDB entries)

8. Domain d1lhpb_: 1lhp B: [77961]

Details for d1lhpb_

PDB Entry: 1lhp, 2.1 Å

PDB Description: Crystal Structure of Pyridoxal Kinase from Sheep Brain

PDB Compounds: (B:) Pyridoxal kinase

SCOPe Domain Sequences for d1lhpb_:

Sequence; same for both SEQRES and ATOM records:

>d1lhpb_ c.72.1.5 (B:) Pyridoxal kinase {Sheep (Ovis aries) [TaxId: 9940]}
ecrvlsiqshvvrgyvgnraatfplqvlgfevdavnsvqfsnhtgyshwkgqvlnsdelq
elydglklnhvnqydyvltgytrdksflamvvdivqelkqqnprlvyvcdpvmgdqrnge
gamyvpddllpvyrekvvpvadiitpnqfeaelltgrkihsqeealevmdmlhsmgpdtv
vitssnllsprgsdylmalgsqrtrapdgsvvtqrirmemhkvdavfvgtgdlfaamlla
wthkhpnnlkvacektvsamhhvlqrtikcakaksgegvkpspaqlelrmvqskkdiesp
eivvqatvl

Timeline for d1lhpb_:

• d1lhpb_ first appeared in SCOP 1.63
  
• d1lhpb_ appears in SCOPe 2.06
  
• d1lhpb_ appears in the current release, SCOPe 2.08