Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
Superfamily c.72.1: Ribokinase-like [53613] (6 families) has extra strand located between strands 2 and 3 |
Family c.72.1.5: PfkB-like kinase [82515] (3 proteins) includes a variety of carbohydrate and pyrimidine kinases |
Protein Pyridoxal kinase [82516] (1 species) |
Species Sheep (Ovis aries) [TaxId:9940] [82517] (8 PDB entries) |
Domain d1lhpb_: 1lhp B: [77961] |
PDB Entry: 1lhp (more details), 2.1 Å
SCOPe Domain Sequences for d1lhpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lhpb_ c.72.1.5 (B:) Pyridoxal kinase {Sheep (Ovis aries) [TaxId: 9940]} ecrvlsiqshvvrgyvgnraatfplqvlgfevdavnsvqfsnhtgyshwkgqvlnsdelq elydglklnhvnqydyvltgytrdksflamvvdivqelkqqnprlvyvcdpvmgdqrnge gamyvpddllpvyrekvvpvadiitpnqfeaelltgrkihsqeealevmdmlhsmgpdtv vitssnllsprgsdylmalgsqrtrapdgsvvtqrirmemhkvdavfvgtgdlfaamlla wthkhpnnlkvacektvsamhhvlqrtikcakaksgegvkpspaqlelrmvqskkdiesp eivvqatvl
Timeline for d1lhpb_: