PDB entry 1lhp

View 1lhp on RCSB PDB site
Description: Crystal Structure of Pyridoxal Kinase from Sheep Brain
Class: transferase
Keywords: alpha-beta structure, transferase
Deposited on 2002-04-17, released 2003-02-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.195
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyridoxal kinase
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lhpa_
  • Chain 'B':
    Compound: Pyridoxal kinase
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lhpb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lhpA (A:)
    meeecrvlsiqshvvrgyvgnraatfplqvlgfevdavnsvqfsnhtgyshwkgqvlnsd
    elqelydglklnhvnqydyvltgytrdksflamvvdivqelkqqnprlvyvcdpvmgdqr
    ngegamyvpddllpvyrekvvpvadiitpnqfeaelltgrkihsqeealevmdmlhsmgp
    dtvvitssnllsprgsdylmalgsqrtrapdgsvvtqrirmemhkvdavfvgtgdlfaam
    llawthkhpnnlkvacektvsamhhvlqrtikcakaksgegvkpspaqlelrmvqskkdi
    espeivvqatvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lhpA (A:)
    ecrvlsiqshvvrgyvgnraatfplqvlgfevdavnsvqfsnhtgyshwkgqvlnsdelq
    elydglklnhvnqydyvltgytrdksflamvvdivqelkqqnprlvyvcdpvmgdqrnge
    gamyvpddllpvyrekvvpvadiitpnqfeaelltgrkihsqeealevmdmlhsmgpdtv
    vitssnllsprgsdylmalgsqrtrgsvvtqrirmemhkvdavfvgtgdlfaamllawth
    khpnnlkvacektvsamhhvlqrtikcakaksgegvkpspaqlelrmvqskkdiespeiv
    vqatvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lhpB (B:)
    meeecrvlsiqshvvrgyvgnraatfplqvlgfevdavnsvqfsnhtgyshwkgqvlnsd
    elqelydglklnhvnqydyvltgytrdksflamvvdivqelkqqnprlvyvcdpvmgdqr
    ngegamyvpddllpvyrekvvpvadiitpnqfeaelltgrkihsqeealevmdmlhsmgp
    dtvvitssnllsprgsdylmalgsqrtrapdgsvvtqrirmemhkvdavfvgtgdlfaam
    llawthkhpnnlkvacektvsamhhvlqrtikcakaksgegvkpspaqlelrmvqskkdi
    espeivvqatvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lhpB (B:)
    ecrvlsiqshvvrgyvgnraatfplqvlgfevdavnsvqfsnhtgyshwkgqvlnsdelq
    elydglklnhvnqydyvltgytrdksflamvvdivqelkqqnprlvyvcdpvmgdqrnge
    gamyvpddllpvyrekvvpvadiitpnqfeaelltgrkihsqeealevmdmlhsmgpdtv
    vitssnllsprgsdylmalgsqrtrapdgsvvtqrirmemhkvdavfvgtgdlfaamlla
    wthkhpnnlkvacektvsamhhvlqrtikcakaksgegvkpspaqlelrmvqskkdiesp
    eivvqatvl