| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.6: Prion-like [54097] (1 superfamily) beta-alpha-beta-alpha(2); antiparallel beta-ribbon |
Superfamily d.6.1: Prion-like [54098] (1 family) ![]() |
| Family d.6.1.1: Prion-like [54099] (3 proteins) |
| Protein Prion-like protein Doppel [64207] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [82572] (1 PDB entry) |
| Domain d1lg4a_: 1lg4 A: [77952] |
PDB Entry: 1lg4 (more details)
SCOPe Domain Sequences for d1lg4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lg4a_ d.6.1.1 (A:) Prion-like protein Doppel {Human (Homo sapiens) [TaxId: 9606]}
aenrpgafikqgrkldidfgaegnryyeanywqfpdgihyngcseanvtkeafvtgcina
tqaanqgefqkpdnklhqqvlwrlvqelcslkhcefwle
Timeline for d1lg4a_: