Lineage for d1lg4a_ (1lg4 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1635622Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 1635623Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 1635624Family d.6.1.1: Prion-like [54099] (3 proteins)
  6. 1635683Protein Prion-like protein Doppel [64207] (2 species)
  7. 1635684Species Human (Homo sapiens) [TaxId:9606] [82572] (1 PDB entry)
  8. 1635685Domain d1lg4a_: 1lg4 A: [77952]

Details for d1lg4a_

PDB Entry: 1lg4 (more details)

PDB Description: nmr structure of the human doppel protein fragment 24-152
PDB Compounds: (A:) prion-like protein

SCOPe Domain Sequences for d1lg4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lg4a_ d.6.1.1 (A:) Prion-like protein Doppel {Human (Homo sapiens) [TaxId: 9606]}
aenrpgafikqgrkldidfgaegnryyeanywqfpdgihyngcseanvtkeafvtgcina
tqaanqgefqkpdnklhqqvlwrlvqelcslkhcefwle

SCOPe Domain Coordinates for d1lg4a_:

Click to download the PDB-style file with coordinates for d1lg4a_.
(The format of our PDB-style files is described here.)

Timeline for d1lg4a_: