Lineage for d1lfwa1 (1lfw A:1-186,A:383-468)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2889494Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2889724Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (18 proteins)
  6. 2889760Protein Aminopeptidase PepV [82450] (1 species)
    unspecific amino dipeptidase
  7. 2889761Species Lactobacillus delbrueckii [TaxId:1584] [82451] (1 PDB entry)
  8. 2889762Domain d1lfwa1: 1lfw A:1-186,A:383-468 [77942]
    Other proteins in same PDB: d1lfwa2
    complexed with aep, zn

Details for d1lfwa1

PDB Entry: 1lfw (more details), 1.8 Å

PDB Description: Crystal structure of pepV
PDB Compounds: (A:) pepV

SCOPe Domain Sequences for d1lfwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lfwa1 c.56.5.4 (A:1-186,A:383-468) Aminopeptidase PepV {Lactobacillus delbrueckii [TaxId: 1584]}
mdlnfkelaeakkdailkdleeliaidssedlenateeypvgkgpvdamtkflsfakrdg
fdtenfanyagrvnfgagdkrlgiighmdvvpagegwtrdpfkmeideegriygrgsadd
kgpsltayygmlllkeagfkpkkkidfvlgtneetnwvgidyylkheptpdivfspdaey
piingeXhyvpgsdpmvqtllkvyekqtgkpghevvigggtygrlfergvafgaqpengp
mvmhaanefmmlddlilsiaiyaeaiyeltkde

SCOPe Domain Coordinates for d1lfwa1:

Click to download the PDB-style file with coordinates for d1lfwa1.
(The format of our PDB-style files is described here.)

Timeline for d1lfwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lfwa2