PDB entry 1lfw

View 1lfw on RCSB PDB site
Description: Crystal structure of pepV
Class: hydrolase
Keywords: Hydrolase, Dipeptidase
Deposited on 2002-04-12, released 2002-10-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-03-19, with a file datestamp of 2014-03-14.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.174
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pepV
    Species: Lactobacillus delbrueckii [TaxId:29397]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1lfwa1, d1lfwa2
  • Heterogens: ZN, AEP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lfwA (A:)
    mdlnfkelaeakkdailkdleeliaidssedlenateeypvgkgpvdamtkflsfakrdg
    fdtenfanyagrvnfgagdkrlgiighmdvvpagegwtrdpfkmeideegriygrgsadd
    kgpsltayygmlllkeagfkpkkkidfvlgtneetnwvgidyylkheptpdivfspdaey
    piingeqgiftlefsfknddtkgdyvldkfkagiatnvtpqvtratisgpdleavklaye
    sfladkeldgsfeindesadivligqgahasapqvgknsatflalfldqyafagrdknfl
    hflaevehedfygkklgifhhddlmgdlasspsmfdyehagkasllnnvrypqgtdpdtm
    ikqvldkfsgildvtyngfeephyvpgsdpmvqtllkvyekqtgkpghevvigggtygrl
    fergvafgaqpengpmvmhaanefmmlddlilsiaiyaeaiyeltkdeel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lfwA (A:)
    mdlnfkelaeakkdailkdleeliaidssedlenateeypvgkgpvdamtkflsfakrdg
    fdtenfanyagrvnfgagdkrlgiighmdvvpagegwtrdpfkmeideegriygrgsadd
    kgpsltayygmlllkeagfkpkkkidfvlgtneetnwvgidyylkheptpdivfspdaey
    piingeqgiftlefsfknddtkgdyvldkfkagiatnvtpqvtratisgpdleavklaye
    sfladkeldgsfeindesadivligqgahasapqvgknsatflalfldqyafagrdknfl
    hflaevehedfygkklgifhhddlmgdlasspsmfdyehagkasllnnvrypqgtdpdtm
    ikqvldkfsgildvtyngfeephyvpgsdpmvqtllkvyekqtgkpghevvigggtygrl
    fergvafgaqpengpmvmhaanefmmlddlilsiaiyaeaiyeltkde