Lineage for d1l4za_ (1l4z A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1545310Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1545311Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1545555Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 1546171Protein Plasmin(ogen), catalytic domain [50588] (1 species)
  7. 1546172Species Human (Homo sapiens) [TaxId:9606] [50589] (8 PDB entries)
  8. 1546185Domain d1l4za_: 1l4z A: [77703]
    Other proteins in same PDB: d1l4zb_
    microplasminogen
    complexed with cd

Details for d1l4za_

PDB Entry: 1l4z (more details), 2.8 Å

PDB Description: x-ray crystal structure of the complex of microplasminogen with alpha domain of streptokinase in the presence cadmium ions
PDB Compounds: (A:) plasminogen

SCOPe Domain Sequences for d1l4za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l4za_ b.47.1.2 (A:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
psfdcgkpqvepkkcpgrvvggcvahphswpwqvslrtrfgmhfcggtlispewvltaah
cleksprpssykvilgahqevnlephvqeievsrlfleptrkdiallklsspavitdkvi
paclpspnyvvadrtecfitgwgetqgtfgagllkeaqlpvienkvcnryeflngrvqst
elcaghlaggtdscqgdaggplvcfekdkyilqgvtswglgcarpnkpgvyvrvsrfvtw
iegvmrnn

SCOPe Domain Coordinates for d1l4za_:

Click to download the PDB-style file with coordinates for d1l4za_.
(The format of our PDB-style files is described here.)

Timeline for d1l4za_: