Class b: All beta proteins [48724] (176 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) |
Protein Plasmin(ogen), catalytic domain [50588] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [50589] (8 PDB entries) |
Domain d1l4za_: 1l4z A: [77703] Other proteins in same PDB: d1l4zb_ microplasminogen complexed with cd |
PDB Entry: 1l4z (more details), 2.8 Å
SCOPe Domain Sequences for d1l4za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l4za_ b.47.1.2 (A:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} psfdcgkpqvepkkcpgrvvggcvahphswpwqvslrtrfgmhfcggtlispewvltaah cleksprpssykvilgahqevnlephvqeievsrlfleptrkdiallklsspavitdkvi paclpspnyvvadrtecfitgwgetqgtfgagllkeaqlpvienkvcnryeflngrvqst elcaghlaggtdscqgdaggplvcfekdkyilqgvtswglgcarpnkpgvyvrvsrfvtw iegvmrnn
Timeline for d1l4za_: