SCOPe 2.05: Domain d1l4za_: 1l4z A:

Lineage for d1l4za_ (1l4z A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Plasmin(ogen), catalytic domain [50588] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50589] (8 PDB entries)

8. Domain d1l4za_: 1l4z A: [77703]
   Other proteins in same PDB: d1l4zb_
   microplasminogen
   complexed with cd

Details for d1l4za_

PDB Entry: 1l4z, 2.8 Å

PDB Description: x-ray crystal structure of the complex of microplasminogen with alpha domain of streptokinase in the presence cadmium ions

PDB Compounds: (A:) plasminogen

SCOPe Domain Sequences for d1l4za_:

Sequence; same for both SEQRES and ATOM records:

>d1l4za_ b.47.1.2 (A:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
psfdcgkpqvepkkcpgrvvggcvahphswpwqvslrtrfgmhfcggtlispewvltaah
cleksprpssykvilgahqevnlephvqeievsrlfleptrkdiallklsspavitdkvi
paclpspnyvvadrtecfitgwgetqgtfgagllkeaqlpvienkvcnryeflngrvqst
elcaghlaggtdscqgdaggplvcfekdkyilqgvtswglgcarpnkpgvyvrvsrfvtw
iegvmrnn

Timeline for d1l4za_:

• d1l4za_ first appeared in SCOP 1.63
  
• d1l4za_ appears in SCOPe 2.04
  
• d1l4za_ appears in SCOPe 2.06
  
• d1l4za_ appears in the current release, SCOPe 2.08