![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.39: Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52732] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 7 strands, order 3214567 |
![]() | Superfamily c.39.1: Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52733] (2 families) ![]() |
![]() | Family c.39.1.1: Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52734] (2 proteins) automatically mapped to Pfam PF02277 |
![]() | Protein Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52735] (2 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [52736] (28 PDB entries) |
![]() | Domain d1l4ga_: 1l4g A: [77687] complexed with mct, ncn |
PDB Entry: 1l4g (more details), 2.1 Å
SCOPe Domain Sequences for d1l4ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l4ga_ c.39.1.1 (A:) Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) {Salmonella typhimurium [TaxId: 90371]} lhallrdipapdaeamartqqhidgllkppgslgrletlavqlagmpglngtpqvgekav lvmcadhgvwdegvavspkivtaiqaanmtrgttgvcvlaaqagakvhvidvgidaepip gvvnmrvargcgniavgpamsrlqaealllevsrytcdlaqrgvtlfgvgelgmanttpa aamvsvftgsdakevvgiganlppsridnkvdvvrraiainqpnprdgidvlskvggfdl vgmtgvmlgaarcglpvlldgflsysaalaacqiapavrpylipshfsaekgarialahl smepylhmamrlgegsgaalampiveaacamfhnmgelaasnivlp
Timeline for d1l4ga_: