SCOPe 2.03: Domain d1l4ga_: 1l4g A:

Lineage for d1l4ga_ (1l4g A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.39: Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52732] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 7 strands, order 3214567

4. Superfamily c.39.1: Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52733] (2 families)

5. Family c.39.1.1: Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52734] (2 proteins)
   automatically mapped to Pfam PF02277

6. Protein Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52735] (2 species)

7. Species Salmonella typhimurium [TaxId:90371] [52736] (28 PDB entries)

8. Domain d1l4ga_: 1l4g A: [77687]
   complexed with mct, ncn

Details for d1l4ga_

PDB Entry: 1l4g, 2.1 Å

PDB Description: crystal structure of cobt complexed with 4-methylcatechol and nicotinate mononucleotide

PDB Compounds: (A:) Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase

SCOPe Domain Sequences for d1l4ga_:

Sequence; same for both SEQRES and ATOM records:

>d1l4ga_ c.39.1.1 (A:) Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) {Salmonella typhimurium [TaxId: 90371]}
lhallrdipapdaeamartqqhidgllkppgslgrletlavqlagmpglngtpqvgekav
lvmcadhgvwdegvavspkivtaiqaanmtrgttgvcvlaaqagakvhvidvgidaepip
gvvnmrvargcgniavgpamsrlqaealllevsrytcdlaqrgvtlfgvgelgmanttpa
aamvsvftgsdakevvgiganlppsridnkvdvvrraiainqpnprdgidvlskvggfdl
vgmtgvmlgaarcglpvlldgflsysaalaacqiapavrpylipshfsaekgarialahl
smepylhmamrlgegsgaalampiveaacamfhnmgelaasnivlp

Timeline for d1l4ga_:

• d1l4ga_ first appeared in SCOP 1.63
  
• d1l4ga_ appears in SCOPe 2.02
  
• d1l4ga_ appears in SCOPe 2.04
  
• d1l4ga_ appears in the current release, SCOPe 2.08