Lineage for d1l4da_ (1l4d A:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 230291Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 230292Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 230387Family b.47.1.2: Eukaryotic proteases [50514] (40 proteins)
  6. 230687Protein Plasmin(ogen), catalytic domain [50588] (1 species)
  7. 230688Species Human (Homo sapiens) [TaxId:9606] [50589] (6 PDB entries)
  8. 230697Domain d1l4da_: 1l4d A: [77683]
    Other proteins in same PDB: d1l4db_
    microplasminogen
    complexed with so4; mutant

Details for d1l4da_

PDB Entry: 1l4d (more details), 2.3 Å

PDB Description: crystal structure of microplasminogen-streptokinase alpha domain complex

SCOP Domain Sequences for d1l4da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l4da_ b.47.1.2 (A:) Plasmin(ogen), catalytic domain {Human (Homo sapiens)}
apsfdcgkpqvepkkcpgrvvggcvahphswpwqvslrtrfgmhfcggtlispewvltaa
hcleksprpssykvilgahqevnlephvqeievsrlfleptrkdiallklsspavitdkv
ipaclpspnyvvadrtecfitgwgetqgtfgagllkeaqlpvienkvcnryeflngrvqs
telcaghlaggtdscqgdaggplvcfekdkyilqgvtswglgcarpnkpgvyvrvsrfvt
wiegvmrnn

SCOP Domain Coordinates for d1l4da_:

Click to download the PDB-style file with coordinates for d1l4da_.
(The format of our PDB-style files is described here.)

Timeline for d1l4da_: