![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) ![]() |
![]() | Family c.66.1.22: Precorrin-6Y methyltransferase (CbiT) [82472] (1 protein) |
![]() | Protein Precorrin-6Y methyltransferase (CbiT) [82473] (1 species) |
![]() | Species Methanobacterium thermoautotrophicum [TaxId:145262] [82474] (5 PDB entries) MTH146 |
![]() | Domain d1l3bh_: 1l3b H: [77670] structural genomics |
PDB Entry: 1l3b (more details), 2.65 Å
SCOPe Domain Sequences for d1l3bh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l3bh_ c.66.1.22 (H:) Precorrin-6Y methyltransferase (CbiT) {Methanobacterium thermoautotrophicum [TaxId: 145262]} mipddefiknpsvpgptamevrclimclaepgkndvavdvgcgtggvtlelagrvrrvya idrnpeaisttemnlqrhglgdnvtlmegdapealckipdidiavvggsggelqeilrii kdklkpggriivtailletkfeameclrdlgfdvnitelniargraldrgtmmvsrnpva liytgv
Timeline for d1l3bh_: